NZD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPROMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
New Products
Product Details
500g Glucose Syrup [ Perfect for use in confectionery etc ]
500g Glucose Syrup [ Perfect for use in confectionery etc ]
Brand:Queen
Product Code:QGLU500X4
weight:500.0g
Product Condition:New
$6.85 inc. tax
$5.96 ex. tax
? Tax based on New Zealand.
Add to Cart
Description


Sorry out of stock, more arriving 7th July

Queen Established 1897

Queen Glucose Syrup is ideal for use in confectionery such as hard candies, caramels, jellies and marshmallows.

Derived from corn, Queen Glucose Syrup is gluten free and can be used in recipes where corn syrup is called for – simply substitute one for one.

10 ways to use up your jar of Queen Glucose Syrup

Marshmallows, Classic Pecan Pie, Granola Bars, Ice Cream, Fudge, Ganache, Turkish delight , Fondant, Honeycomb and Nougat

Nutritional Information

Serving Size: 100 g 
Servings Per Package: 5		 Avg. Qty. per Serve Avg. Qty. per 100g
Energy 1330 kJ (318 Cal) 1330 kJ (318 Cal)
Protein LESS THAN 1 g LESS THAN 1 g
Fat, total 0.0 g 0.0 g
… saturated 0.0 g 0.0 g
Carbohydrate 78 g 78 g
… sugars 28 g 28 g
Dietary fibre, total LESS THAN 1 g LESS THAN 1 g
Sodium 29 mg 29 mg

Ingredients

Glucose Syrup - derived from corn - non GMO - hooray! and Preservative (220).

Allergy Information

Gluten Free, Egg Free, Peanut Free, Soy Free, Vegan.

Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------